McDonnell Genome Institute

Washington University

Transcript

lnc-PRAC2-6:1

Chromosome

chr17

Gene Name

lnc-PRAC2-6

Start

48617097

CPC Label

noncoding

End

48622528

Cancer

OV

Strand

+

Peptide

FGMQGAVNNQGAGLR

Modified Peptide

n[145]FGM[147]QGAVNNQGAGLR

Peptide Length

15

ORF Length

135

Open Reading Frame (ORF)

LMEGKCFCYRKKKKKKRKSEETIYKHPAERRFIRETQVEEKLRLPPCTKSWWGRGEAAAGVILRGWEYLLLAQVCRMEGRDPAGPGGHRRFGMQGAVNNQGAGLRTKVPGVQTSSCSMRKGPAPPGLPAARAKAH

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.354649

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.1857

PhyloCSF Frame 3

0

CNTI Score

-0.298480115