McDonnell Genome Institute

Washington University

Transcript

lnc-PRAC2-13:1

Chromosome

chr17

Gene Name

lnc-PRAC2-13

Start

48585513

CPC Label

noncoding

End

48586082

Cancer

HCC

Strand

+

Peptide

ALSVSLPPK

Modified Peptide

n[230]ALSVSLPPK

Peptide Length

9

ORF Length

78

Open Reading Frame (ORF)

LAAPGCYSLCLWSRAAAVRTTRALSVSLPPKYRLPDPHLSLGRISFLPPWDPLGFRKQKRKRIREMHAPKDKPAGAPK

Conservation Score

1

PhyloCSF Frame 1

-0.591

No. of Spectra

3

CPC Coding Probability

0.0254485

PhyloCSF Frame 2 

1.837

CNTI Index

noncoding

Max Probability

0.8251

PhyloCSF Frame 3

-2.423

CNTI Score

-0.375942637