McDonnell Genome Institute

Washington University

Transcript

lnc-PRAC1-1:1

Chromosome

chr17

Gene Name

lnc-PRAC1-1

Start

48691115

CPC Label

coding

End

48691694

Cancer

EOGC

Strand

-

Peptide

DEFILEGNDIELVSNSAALIQQATTVK

Modified Peptide

n[145]DEFILEGNDIELVSNSAALIQQATTVK

Peptide Length

27

ORF Length

75

Open Reading Frame (ORF)

LGEKYIHGVQMRPGVACSVSQAQKDEFILEGNDIELVSNSAALIQQATTVKNKDIRKFLNGIYVSEKGTVQQADE

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.642011

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.1206

PhyloCSF Frame 3

0

CNTI Score

0.594072195