McDonnell Genome Institute

Washington University

Transcript

lnc-PQLC1-104:13

Chromosome

chr18

Gene Name

lnc-PQLC1-104

Start

79671610

CPC Label

noncoding

End

79679297

Cancer

EOGC

Strand

-

Peptide

FIETENK

Modified Peptide

n[145]FIETENK

Peptide Length

7

ORF Length

42

Open Reading Frame (ORF)

LCNTVLFPFCEMPKVKFIETENKMVVTRAGGRVGSCLMGTEF

Conservation Score

0.445

PhyloCSF Frame 1

0

No. of Spectra

170

CPC Coding Probability

0.0593404

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9997

PhyloCSF Frame 3

0

CNTI Score

-0.344731093