McDonnell Genome Institute

Washington University

Transcript

lnc-PPT1-2:1

Chromosome

chr1

Gene Name

lnc-PPT1-2

Start

40029013

CPC Label

noncoding

End

40030573

Cancer

OV

Strand

-

Peptide

VSMRFPEYAGLK

Modified Peptide

n[145]VSMRFPEYAGLK

Peptide Length

12

ORF Length

53

Open Reading Frame (ORF)

MRKLMVKGDKFCMRHVQFKVSMRFPEYAGLKFRRQVWPEGVDLRVPRFFFFFF

Conservation Score

0.989

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0318308

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6251

PhyloCSF Frame 3

0

CNTI Score

-0.381496973