McDonnell Genome Institute

Washington University

Transcript

lnc-PPP4R3A-1:1

Chromosome

chr14

Gene Name

lnc-PPP4R3A-1

Start

91519188

CPC Label

noncoding

End

91526797

Cancer

CCRC

Strand

-

Peptide

GGSGLYSR

Modified Peptide

n[230]GGSGLYSR

Peptide Length

8

ORF Length

56

Open Reading Frame (ORF)

LCMYNTFHNLKQTLTSSDRLISCTLMSRKFRDRKTTARRGGSGLYSRLGRRGGWIT

Conservation Score

0.093

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.287182

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9967

PhyloCSF Frame 3

0

CNTI Score

0.662576785