McDonnell Genome Institute

Washington University

Transcript

lnc-PPP4R2-4:1

Chromosome

chr3

Gene Name

lnc-PPP4R2-4

Start

73148646

CPC Label

noncoding

End

73148854

Cancer

OV

Strand

+

Peptide

LAGMIFPETK

Modified Peptide

n[145]LAGMIFPETK

Peptide Length

10

ORF Length

33

Open Reading Frame (ORF)

LAGMIFPETKGLEPTWAKPPSLRHKLLLANAHS

Conservation Score

1

PhyloCSF Frame 1

-3.372

No. of Spectra

2

CPC Coding Probability

0.169515

PhyloCSF Frame 2 

-3.692

CNTI Index

noncoding

Max Probability

0.8313

PhyloCSF Frame 3

-5.04

CNTI Score

-0.437086618