McDonnell Genome Institute

Washington University

Transcript

lnc-PPP4R1-21:2

Chromosome

chr18

Gene Name

lnc-PPP4R1-21

Start

8702550

CPC Label

noncoding

End

8704858

Cancer

OV

Strand

-

Peptide

NYGQDSQHK

Modified Peptide

n[145]NYGQDSQHK

Peptide Length

9

ORF Length

49

Open Reading Frame (ORF)

LPRTSSRGSEASHTLTFPKNYGQDSQHKLASFSYHIHSKKGPPKKVSIR

Conservation Score

0.549

PhyloCSF Frame 1

-4.805

No. of Spectra

90

CPC Coding Probability

0.0454615

PhyloCSF Frame 2 

-4.862

CNTI Index

noncoding

Max Probability

0.9296

PhyloCSF Frame 3

-3.041

CNTI Score

-0.316077034