McDonnell Genome Institute

Washington University

Transcript

lnc-PPP4R1-2:8

Chromosome

chr18

Gene Name

lnc-PPP4R1-2

Start

9317322

CPC Label

coding

End

9334445

Cancer

BRCA-Luminal B

Strand

-

Peptide

HQADLQVGQGR

Modified Peptide

n[145]HQADLQVGQGR

Peptide Length

11

ORF Length

53

Open Reading Frame (ORF)

MALMRFQVQHKHQADLQVGQGRVRNSSGALLGLPLSSKQQHSSRTFHREFPTM

Conservation Score

0.296

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.555627

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9948

PhyloCSF Frame 3

0

CNTI Score

-0.364019669