McDonnell Genome Institute

Washington University

Transcript

lnc-PPP4R1-2:7

Chromosome

chr18

Gene Name

lnc-PPP4R1-2

Start

9317149

CPC Label

noncoding

End

9334493

Cancer

OV

Strand

-

Peptide

MLLQILFSIHMNYK

Modified Peptide

n[145]MLLQILFSIHM[147]NYK

Peptide Length

14

ORF Length

41

Open Reading Frame (ORF)

MLLQILFSIHMNYKLKNIDKYQQLHRKKKVVVKNKNHCYVL

Conservation Score

0.033

PhyloCSF Frame 1

-4.417

No. of Spectra

5

CPC Coding Probability

0.0265583

PhyloCSF Frame 2 

-4.932

CNTI Index

noncoding

Max Probability

0.9219

PhyloCSF Frame 3

-5.126

CNTI Score

-0.371707146