McDonnell Genome Institute

Washington University

Transcript

lnc-PPP4R1-18:1

Chromosome

chr18

Gene Name

lnc-PPP4R1-18

Start

9912337

CPC Label

noncoding

End

9914347

Cancer

PRAD

Strand

-

Peptide

ASATHVTASACLR

Modified Peptide

ASATHVTASACLR

Peptide Length

13

ORF Length

184

Open Reading Frame (ORF)

LWADRGPGSARASPWPLRRTPSERQRRAGARPRRRFADWGRGTTAATARPSSRTRPGSRLPSPNACRCVTGSVGHPLGQQLRVPQLTQPHTSRHGHAHLRASATHVTASACLRARPRPGASSACPALQAGLARRGAAAPARSRLAAARSAAQLSRERVWKEAGQRSAGPTRCAAQGWKRSPLSP

Conservation Score

1

PhyloCSF Frame 1

6.53

No. of Spectra

30

CPC Coding Probability

0.0122148

PhyloCSF Frame 2 

2.391

CNTI Index

noncoding

Max Probability

0.9978

PhyloCSF Frame 3

6.512

CNTI Score

-0.265247623