McDonnell Genome Institute

Washington University

Transcript

lnc-PPP4R1-12:2

Chromosome

chr18

Gene Name

lnc-PPP4R1-12

Start

9473184

CPC Label

noncoding

End

9475217

Cancer

CCRC

Strand

-

Peptide

VWASAGLQR

Modified Peptide

‚Äč

Peptide Length

9

ORF Length

79

Open Reading Frame (ORF)

LGAARLAAGWGGCPAFDWVWDWRKERRGPVGIGGNKPLSGTSTEFLKRVWASAGLQRAPGSAVTEQPPRKAAQSVFGWQ

Conservation Score

0.456

PhyloCSF Frame 1

-0.603

No. of Spectra

1

CPC Coding Probability

0.11839

PhyloCSF Frame 2 

-1.464

CNTI Index

noncoding

Max Probability

0.655

PhyloCSF Frame 3

-3.636

CNTI Score

-0.353862889