McDonnell Genome Institute

Washington University

Transcript

lnc-PPP4R1-11:1

Chromosome

chr18

Gene Name

lnc-PPP4R1-11

Start

8360819

CPC Label

noncoding

End

8367034

Cancer

OV

Strand

-

Peptide

EEGRAQAAAFLLCLLCQQLSPSTGRSLGR

Modified Peptide

n[145]EEGRAQAAAFLLCLLCQQLSPSTGRSLGR

Peptide Length

29

ORF Length

129

Open Reading Frame (ORF)

LEVPVGAQEPRNGRRPCSDRAPGLAASCSPALPAQLLGEAAPPTHPNHMSTGIQRPRSPWRPGERRQGVPEKEEGRAQAAAFLLCLLCQQLSPSTGRSLGRTEGCHKELLNRSKGIEGWSDMIYDLPNP

Conservation Score

0.148

PhyloCSF Frame 1

-4.57

No. of Spectra

1

CPC Coding Probability

0.0695419

PhyloCSF Frame 2 

-3.405

CNTI Index

noncoding

Max Probability

0.1795

PhyloCSF Frame 3

-0.803

CNTI Score

-0.31945309