McDonnell Genome Institute

Washington University

Transcript

lnc-PPP2R3C-4:1

Chromosome

chr14

Gene Name

lnc-PPP2R3C-4

Start

35199302

CPC Label

noncoding

End

35246506

Cancer

BRCA-Luminal A

Strand

-

Peptide

ENIGGVK

Modified Peptide

n[145]ENIGGVK

Peptide Length

7

ORF Length

86

Open Reading Frame (ORF)

LVQKHRLKGVTKHSASLKMHFKSNIHSTFFFVPMTCQTPCWMLRFLKQITDPVVKELRSLQWCDWWYDRDYSKLLRENIGGVKCTD

Conservation Score

0.471

PhyloCSF Frame 1

-5.539

No. of Spectra

52

CPC Coding Probability

0.0833571

PhyloCSF Frame 2 

-4.692

CNTI Index

noncoding

Max Probability

0.9998

PhyloCSF Frame 3

-3.648

CNTI Score

-0.33000849