McDonnell Genome Institute

Washington University

Transcript

lnc-PPP2R2C-1:3

Chromosome

chr4

Gene Name

lnc-PPP2R2C-1

Start

6297849

CPC Label

coding

End

6308616

Cancer

BRCA-Luminal B

Strand

-

Peptide

DGACQVQDGPCR

Modified Peptide

n[145]DGACQVQDGPCR

Peptide Length

12

ORF Length

99

Open Reading Frame (ORF)

LKHLEEMQWIQTGKRCGSVPFPGKSSSLGDVRKTFQGSWTFKEAKDGACQVQDGPCRWRCSHRIPGIHCSLVTYQCWHCIGYPEFNSLKPHSSSYTLWG

Conservation Score

0.233

PhyloCSF Frame 1

-4.683

No. of Spectra

44

CPC Coding Probability

0.998215

PhyloCSF Frame 2 

-5.328

CNTI Index

noncoding

Max Probability

0.9984

PhyloCSF Frame 3

-4.161

CNTI Score

-0.282130329