McDonnell Genome Institute

Washington University

Transcript

lnc-PPP2R2B-3:1

Chromosome

chr5

Gene Name

lnc-PPP2R2B-3

Start

146581145

CPC Label

noncoding

End

146583352

Cancer

OV

Strand

-

Peptide

LAFSFAWVSTILQGK

Modified Peptide

n[145]LAFSFAWVSTILQGK

Peptide Length

15

ORF Length

120

Open Reading Frame (ORF)

LMQEATLSHPRYCPHTQAAALNIPHNKAKGSDKSYYSQPSHLETRGETNLPLDVLRERQDPQRNLSELSTCLIQQDRDGRRLAFSFAWVSTILQGKLCGQLGNTTINWRGMNNRVSGAVC

Conservation Score

1

PhyloCSF Frame 1

-3.82

No. of Spectra

51

CPC Coding Probability

0.163462

PhyloCSF Frame 2 

-3.213

CNTI Index

noncoding

Max Probability

0.9814

PhyloCSF Frame 3

-2.435

CNTI Score

-0.365649379