McDonnell Genome Institute

Washington University

Transcript

lnc-PPP1R3G-9:2

Chromosome

chr6

Gene Name

lnc-PPP1R3G-9

Start

5022452

CPC Label

noncoding

End

5048275

Cancer

EOGC

Strand

+

Peptide

AGLTCFTSR

Modified Peptide

n[145]AGLTCFTSR

Peptide Length

9

ORF Length

64

Open Reading Frame (ORF)

LFSFKQLGNLLSSSPVPGSSFRRAGLTCFTSRSPCAAWSFPLTCLLDLFQKGGHGFFFSFLGPD

Conservation Score

0.393

PhyloCSF Frame 1

-4.296

No. of Spectra

4

CPC Coding Probability

0.383638

PhyloCSF Frame 2 

-4.408

CNTI Index

noncoding

Max Probability

0.596

PhyloCSF Frame 3

-4.175

CNTI Score

-0.32714123