McDonnell Genome Institute

Washington University

Transcript

lnc-PPP1R3G-5:1

Chromosome

chr6

Gene Name

lnc-PPP1R3G-5

Start

4713389

CPC Label

noncoding

End

4717336

Cancer

OV

Strand

+

Peptide

LEEVVVAGAVR

Modified Peptide

n[145]LEEVVVAGAVR

Peptide Length

11

ORF Length

38

Open Reading Frame (ORF)

LEEVVVAGAVRGSHLRLQYFKEADSTPTASRAWCSWGF

Conservation Score

0.062

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.00883209

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5866

PhyloCSF Frame 3

0

CNTI Score

-0.433277115