McDonnell Genome Institute

Washington University

Transcript

lnc-PPP1R3D-4:1

Chromosome

chr20

Gene Name

lnc-PPP1R3D-4

Start

60812003

CPC Label

noncoding

End

60814211

Cancer

BRCA-Luminal B

Strand

-

Peptide

CAIMGLIGCLHNFSSANYK

Modified Peptide

n[145]CAIMGLIGCLHNFSSANYK

Peptide Length

19

ORF Length

57

Open Reading Frame (ORF)

LNLKKCAIMGLIGCLHNFSSANYKGIFIHVPPKILSGKISPFGNYRIIISSNVQLLT

Conservation Score

0.292

PhyloCSF Frame 1

-4.439

No. of Spectra

2

CPC Coding Probability

0.023631

PhyloCSF Frame 2 

-5.423

CNTI Index

noncoding

Max Probability

0.9956

PhyloCSF Frame 3

-4.751

CNTI Score

-0.352730311