McDonnell Genome Institute

Washington University

Transcript

lnc-PPP1R3D-2:3

Chromosome

chr20

Gene Name

lnc-PPP1R3D-2

Start

60332332

CPC Label

noncoding

End

60334087

Cancer

EOGC

Strand

-

Peptide

ASVYMEAINLR

Modified Peptide

n[145]ASVYM[147]EAINLR

Peptide Length

11

ORF Length

57

Open Reading Frame (ORF)

LAQPRCKPSWAGTEHPDCRSLLPDSRASVYMEAINLRSQEAHFRMGSVPHSGGRNAV

Conservation Score

0.044

PhyloCSF Frame 1

0

No. of Spectra

11

CPC Coding Probability

0.0132741

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9979

PhyloCSF Frame 3

0

CNTI Score

-0.408263639