McDonnell Genome Institute

Washington University

Transcript

lnc-PPP1R3D-10:1

Chromosome

chr20

Gene Name

lnc-PPP1R3D-10

Start

60510616

CPC Label

noncoding

End

60511209

Cancer

CRC

Strand

-

Peptide

QPQLPSEARLPK

Modified Peptide

‚Äč

Peptide Length

12

ORF Length

46

Open Reading Frame (ORF)

LINPLAPSHSPTHPSKKNQRPFLPDLNLFKQPQLPSEARLPKLPCV

Conservation Score

0.009

PhyloCSF Frame 1

-4.239

No. of Spectra

1

CPC Coding Probability

0.00968903

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6498

PhyloCSF Frame 3

0

CNTI Score

-0.402416291