McDonnell Genome Institute

Washington University

Transcript

lnc-PPP1R3C-4:1

Chromosome

chr10

Gene Name

lnc-PPP1R3C-4

Start

91481811

CPC Label

noncoding

End

91483610

Cancer

OV

Strand

-

Peptide

LILMASLYFTMTFLGK

Modified Peptide

n[145]LILM[147]ASLYFTM[147]TFLGK

Peptide Length

16

ORF Length

50

Open Reading Frame (ORF)

LPFYFYQSWRSHCSCGYSSVKKVLCFYKLILMASLYFTMTFLGKEKAPFK

Conservation Score

0.595

PhyloCSF Frame 1

-4.817

No. of Spectra

2

CPC Coding Probability

0.0177399

PhyloCSF Frame 2 

-4.718

CNTI Index

noncoding

Max Probability

0.7163

PhyloCSF Frame 3

-5.871

CNTI Score

-0.412076627