McDonnell Genome Institute

Washington University

Transcript

lnc-PPP1R26-7:1

Chromosome

chr9

Gene Name

lnc-PPP1R26-7

Start

135343248

CPC Label

noncoding

End

135346562

Cancer

HCC

Strand

+

Peptide

NLPPSLPAPR

Modified Peptide

n[230]NLPPSLPAPR

Peptide Length

10

ORF Length

148

Open Reading Frame (ORF)

LPGTRSKAPAGGLWATVWAPTSRRACHGLCTKLVRCLLQELAPSLPLPCQPTLSGFCHKREKNLPPSLPAPRLLLLHFLQIKQHAWSRACWLCSELHFGHPWAALLLVGWLQEQVPGVPAAVPTPLRTQRTPAFGANHTASNWAWKLP

Conservation Score

0.27

PhyloCSF Frame 1

-4.171

No. of Spectra

12

CPC Coding Probability

0.392773

PhyloCSF Frame 2 

-2.937

CNTI Index

noncoding

Max Probability

0.9985

PhyloCSF Frame 3

-1.203

CNTI Score

-0.295672939