McDonnell Genome Institute

Washington University

Transcript

lnc-PPP1R26-3:1

Chromosome

chr9

Gene Name

lnc-PPP1R26-3

Start

135469112

CPC Label

noncoding

End

135469802

Cancer

OV

Strand

+

Peptide

WRYLHSRQGELFGR

Modified Peptide

n[145]WRYLHSRQGELFGR

Peptide Length

14

ORF Length

34

Open Reading Frame (ORF)

LHELFFLHCNSSVLIKWRYLHSRQGELFGRLQRL

Conservation Score

0.127

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.103154

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6886

PhyloCSF Frame 3

0

CNTI Score

-0.470499671