McDonnell Genome Institute

Washington University

Transcript

lnc-PPP1R1A-1:1

Chromosome

chr12

Gene Name

lnc-PPP1R1A-1

Start

54608186

CPC Label

noncoding

End

54610462

Cancer

OSCC

Strand

-

Peptide

LQLEETTELAPR

Modified Peptide

n[145]LQLEETTELAPR

Peptide Length

12

ORF Length

67

Open Reading Frame (ORF)

MLSKEHTPQEDNFKNVKLQLEETTELAPRAGMSQGRGKPPGSTPQQPPQRENLPNWPIKSGRIWTKH

Conservation Score

1

PhyloCSF Frame 1

-3.242

No. of Spectra

7

CPC Coding Probability

0.0837786

PhyloCSF Frame 2 

-4.79

CNTI Index

noncoding

Max Probability

0.9158

PhyloCSF Frame 3

-3.601

CNTI Score

-0.360365885