McDonnell Genome Institute

Washington University

Transcript

lnc-PPP1CB-1:1

Chromosome

chr2

Gene Name

lnc-PPP1CB-1

Start

28713301

CPC Label

noncoding

End

28726000

Cancer

OV

Strand

+

Peptide

ISWAWCQAPVIPVTQEAEAGESLELGR

Modified Peptide

n[145]ISWAWCQAPVIPVTQEAEAGESLELGR

Peptide Length

27

ORF Length

54

Open Reading Frame (ORF)

MRSGVRDQPGQHSETPCLLKIQKISWAWCQAPVIPVTQEAEAGESLELGRRRLQ

Conservation Score

0.073

PhyloCSF Frame 1

0

No. of Spectra

16

CPC Coding Probability

0.0385153

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8024

PhyloCSF Frame 3

0

CNTI Score

-0.336851443