McDonnell Genome Institute

Washington University

Transcript

lnc-PPM1M-2:5

Chromosome

chr3

Gene Name

lnc-PPM1M-2

Start

52239234

CPC Label

noncoding

End

52244647

Cancer

OV

Strand

+

Peptide

GTPTGAGLAAGR

Modified Peptide

n[145]GTPTGAGLAAGR

Peptide Length

12

ORF Length

87

Open Reading Frame (ORF)

MKQHPPELLPSLQGAWWAEAWLVSISTAFLCPVWPQQTLWVQSISPQAGLGLSHRREWVLGTGPCPKNLPSWARGTPTGAGLAAGRK

Conservation Score

0.992

PhyloCSF Frame 1

-3.775

No. of Spectra

3

CPC Coding Probability

0.0794347

PhyloCSF Frame 2 

-4.158

CNTI Index

noncoding

Max Probability

0.9536

PhyloCSF Frame 3

-5.345

CNTI Score

-0.304597558