McDonnell Genome Institute

Washington University

Transcript

lnc-PPM1K-2:1

Chromosome

chr4

Gene Name

lnc-PPM1K-2

Start

88220568

CPC Label

noncoding

End

88223837

Cancer

LUAD

Strand

-

Peptide

MIINHAHTVVVCVR

Modified Peptide

n[272]MIINHAHTVVVCVR

Peptide Length

14

ORF Length

40

Open Reading Frame (ORF)

MIINHAHTVVVCVRCSTVLCQSTGGKARLTEGCSFRRKQQ

Conservation Score

1

PhyloCSF Frame 1

-3.571

No. of Spectra

1

CPC Coding Probability

0.0158413

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9682

PhyloCSF Frame 3

0

CNTI Score

-0.43652044