McDonnell Genome Institute

Washington University

Transcript

lnc-PPM1J-6:1

Chromosome

chr1

Gene Name

lnc-PPM1J-6

Start

112704639

CPC Label

noncoding

End

112707127

Cancer

BRCA-Luminal A

Strand

-

Peptide

RCDELCR

Modified Peptide

n[145]RCDELCR

Peptide Length

7

ORF Length

41

Open Reading Frame (ORF)

LRRCDELCRCSLCVLGVGDTWKPGKLTPCPESQGGVGRACG

Conservation Score

1

PhyloCSF Frame 1

-1.175

No. of Spectra

130

CPC Coding Probability

0.0796183

PhyloCSF Frame 2 

-2.942

CNTI Index

noncoding

Max Probability

0.9998

PhyloCSF Frame 3

-3.315

CNTI Score

-0.360612561