McDonnell Genome Institute

Washington University

Transcript

lnc-PPM1H-5:2

Chromosome

chr12

Gene Name

lnc-PPM1H-5

Start

62234389

CPC Label

coding

End

62235515

Cancer

PRAD

Strand

-

Peptide

LPLSDSHSFPDDLLSGSVSPSAR

Modified Peptide

‚Äč

Peptide Length

23

ORF Length

78

Open Reading Frame (ORF)

LPLSDSHSFPDDLLSGSVSPSARDDDFQWAPDNACRRGQYSKGGQGLQAASLSFHWNSSDVSYWGPYNALPWPLDSTF

Conservation Score

0.528

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.619145

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9878

PhyloCSF Frame 3

0

CNTI Score

-0.318468626