McDonnell Genome Institute

Washington University

Transcript

lnc-PPM1H-1:1

Chromosome

chr12

Gene Name

lnc-PPM1H-1

Start

63003678

CPC Label

noncoding

End

63006901

Cancer

OV

Strand

-

Peptide

GLLFRGQLSLYK

Modified Peptide

n[145]GLLFRGQLSLYK

Peptide Length

12

ORF Length

33

Open Reading Frame (ORF)

MGLLFRGQLSLYKVGNTLLSKEGILRKTSSFIP

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.0290738

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9968

PhyloCSF Frame 3

0

CNTI Score

-0.396914631