McDonnell Genome Institute

Washington University

Transcript

lnc-PPM1G-3:1

Chromosome

chr2

Gene Name

lnc-PPM1G-3

Start

27425047

CPC Label

noncoding

End

27428493

Cancer

CRC

Strand

-

Peptide

LPGALSLSTFR

Modified Peptide

Peptide Length

11

ORF Length

39

Open Reading Frame (ORF)

LPGALSLSTFRFQLGPFKYAWRTLWHPLALIFNPSLHLK

Conservation Score

0.994

PhyloCSF Frame 1

-5.198

No. of Spectra

1

CPC Coding Probability

0.054197

PhyloCSF Frame 2 

-5.686

CNTI Index

noncoding

Max Probability

0.7454

PhyloCSF Frame 3

-4.83

CNTI Score

-0.350939607