McDonnell Genome Institute

Washington University

Transcript

lnc-PPM1D-1:3

Chromosome

chr17

Gene Name

lnc-PPM1D-1

Start

60538433

CPC Label

noncoding

End

60542508

Cancer

OV

Strand

+

Peptide

LQLAEIVPLHSSLGDTAR

Modified Peptide

n[145]LQLAEIVPLHSSLGDTAR

Peptide Length

18

ORF Length

86

Open Reading Frame (ORF)

MPVIPATREAEAGESLEPWRWQRLQLAEIVPLHSSLGDTARLCLKKKKNPIPASCRGTHLKLHHFGRQRRGLLLELQSSRPAWATW

Conservation Score

0.065

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0708923

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6038

PhyloCSF Frame 3

0

CNTI Score

-0.379489985