McDonnell Genome Institute

Washington University

Transcript

lnc-PPIL2-1:3

Chromosome

chr22

Gene Name

lnc-PPIL2-1

Start

21938292

CPC Label

noncoding

End

21943422

Cancer

OV

Strand

+

Peptide

MGLLGLSDPGVEGGLAR

Modified Peptide

n[145]M[147]GLLGLSDPGVEGGLAR

Peptide Length

17

ORF Length

46

Open Reading Frame (ORF)

MGLLGLSDPGVEGGLARRGRLSKGESLRPGLGRAMVTNRSRQSRAV

Conservation Score

0.151

PhyloCSF Frame 1

-3.713

No. of Spectra

3

CPC Coding Probability

0.062773

PhyloCSF Frame 2 

-4.893

CNTI Index

noncoding

Max Probability

0.9808

PhyloCSF Frame 3

-5.488

CNTI Score

-0.318975729