McDonnell Genome Institute

Washington University

Transcript

lnc-PPIE-1:4

Chromosome

chr1

Gene Name

lnc-PPIE-1

Start

39799440

CPC Label

noncoding

End

39806080

Cancer

HCC

Strand

+

Peptide

LTSIDVK

Modified Peptide

n[230]LTSIDVK

Peptide Length

7

ORF Length

42

Open Reading Frame (ORF)

LTSIDVKIESIRLTEQTFVAIRYKIIGWARWLTPVIPALWGG

Conservation Score

0.132

PhyloCSF Frame 1

0

No. of Spectra

10

CPC Coding Probability

0.345434

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.998

PhyloCSF Frame 3

0

CNTI Score

-0.369204705