McDonnell Genome Institute

Washington University

Transcript

lnc-PPIE-1:1

Chromosome

chr1

Gene Name

lnc-PPIE-1

Start

39788975

CPC Label

noncoding

End

39790171

Cancer

OSCC

Strand

+

Peptide

GSQPGRQRGHGR

Modified Peptide

n[145]GSQPGRQRGHGR

Peptide Length

12

ORF Length

125

Open Reading Frame (ORF)

LGVAGGQAARARGSQPGRQRGHGRRGFRRGPRRRDPRAAAPFRSRQWCHPAAPPSRARVAMACCRRLLPGTCSAAPPRAPTWLPREPGQRPRQAAPASPRCAACAPCAPSTDPASRGRRAPASCL

Conservation Score

0.145

PhyloCSF Frame 1

-4.077

No. of Spectra

3

CPC Coding Probability

0.326887

PhyloCSF Frame 2 

-3.893

CNTI Index

noncoding

Max Probability

0.8264

PhyloCSF Frame 3

0

CNTI Score

-0.259649531