McDonnell Genome Institute

Washington University

Transcript

lnc-PPIAL4D-19:12

Chromosome

chr1

Gene Name

lnc-PPIAL4D-19

Start

145168420

CPC Label

noncoding

End

145215814

Cancer

LUAD

Strand

-

Peptide

AEDCLFADFR

Modified Peptide

n[230]AEDCLFADFR

Peptide Length

10

ORF Length

92

Open Reading Frame (ORF)

LKACEGGGVEIAAASFPRIYLMGMCSRQDRIQKDIDVVIQKSRAEDCLFADFRYSDSTFTFTYVGGPRRTTVQTTKLRKTGEAESTNRVVAR

Conservation Score

1

PhyloCSF Frame 1

7.09

No. of Spectra

3

CPC Coding Probability

0.0888564

PhyloCSF Frame 2 

4.806

CNTI Index

noncoding

Max Probability

0.8943

PhyloCSF Frame 3

0.615

CNTI Score

-0.28699962