McDonnell Genome Institute

Washington University

Transcript

lnc-PPEF1-7:5

Chromosome

chrX

Gene Name

lnc-PPEF1-7

Start

18984193

CPC Label

noncoding

End

19083141

Cancer

CCRC

Strand

+

Peptide

STIESPRK

Modified Peptide

n[230]STIESPRK

Peptide Length

8

ORF Length

38

Open Reading Frame (ORF)

LNAHSKAIGLARRNRSTIESPRKRKYLKKRELQVGVRS

Conservation Score

0.987

PhyloCSF Frame 1

-2.381

No. of Spectra

19

CPC Coding Probability

0.0160234

PhyloCSF Frame 2 

-3.501

CNTI Index

coding

Max Probability

0.9933

PhyloCSF Frame 3

-3.132

CNTI Score

0.719154731