McDonnell Genome Institute

Washington University

Transcript

lnc-PPDPFL-7:1

Chromosome

chr8

Gene Name

lnc-PPDPFL-7

Start

48913859

CPC Label

noncoding

End

48914263

Cancer

CCRC

Strand

+

Peptide

SIITCQVSLLDGTDVSVDLPK

Modified Peptide

n[230]SIITCQVSLLDGTDVSVDLPK

Peptide Length

21

ORF Length

98

Open Reading Frame (ORF)

MLSFFRRTLGSRSMGKHAEKERLREAQCAATHIPAPGDSRSIITCQVSLLDGTDVSVDLPKKAKGQELFDQIMYHLDLIESGYFDLRFMDSAQVASPK

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.435148

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4153

PhyloCSF Frame 3

0

CNTI Score

-0.329741279