McDonnell Genome Institute

Washington University

Transcript

lnc-PPDPFL-5:3

Chromosome

chr8

Gene Name

lnc-PPDPFL-5

Start

48590400

CPC Label

coding

End

48594621

Cancer

OV

Strand

+

Peptide

GFYCLSQLQQHNMR

Modified Peptide

n[145]GFYCLSQLQQHNMR

Peptide Length

14

ORF Length

190

Open Reading Frame (ORF)

MGPGIVLVSSHGKMLDLTMTRAAKIGLYLSEPIESSTSTTRGFYCLSQLQQHNMRQGPRTAELCTVFRRGCELLLCRVGRCFRALQAPCRPLLTVHGLHLPYLLSCPISCSWLWFPEGSRLHRLPCVLTLWWVCKWQSPGKETGEHGHGSSGGHGGFRLPPRSTCFISSGHQDCITRTMTTLRALLQLKT

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.509281

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7682

PhyloCSF Frame 3

0

CNTI Score

-0.306728246