McDonnell Genome Institute

Washington University

Transcript

lnc-PPDPFL-2:12

Chromosome

chr8

Gene Name

lnc-PPDPFL-2

Start

49224937

CPC Label

noncoding

End

49229787

Cancer

OV

Strand

+

Peptide

LLAEFEMIHPPCK

Modified Peptide

n[145]LLAEFEMIHPPCK

Peptide Length

13

ORF Length

52

Open Reading Frame (ORF)

LLAEFEMIHPPCKTVWTFLKGLNIELPYDPKTLLFDTYTRRMETYIHTKAET

Conservation Score

0.092

PhyloCSF Frame 1

0

No. of Spectra

25

CPC Coding Probability

0.0931733

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7879

PhyloCSF Frame 3

0

CNTI Score

-0.439009109