McDonnell Genome Institute

Washington University

Transcript

lnc-PPDPFL-17:1

Chromosome

chr8

Gene Name

lnc-PPDPFL-17

Start

50490794

CPC Label

noncoding

End

50491465

Cancer

LUAD

Strand

+

Peptide

ATSQMEQQGR

Modified Peptide

n[230]ATSQM[147]EQQGR

Peptide Length

10

ORF Length

125

Open Reading Frame (ORF)

LELEPKPINHVYIAQTSSASGDWKSHAWKPWTQRATSQMEQQGRDTDVLGPGPFLPRWGCSHHGFCREPLIPSSPEFTRDLETHLGQPTIQYFESVGTKQRDSIRMTYLRKNDIFLGLWEFATST

Conservation Score

0.517

PhyloCSF Frame 1

0

No. of Spectra

11

CPC Coding Probability

0.166178

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.997

PhyloCSF Frame 3

0

CNTI Score

-0.407259025