McDonnell Genome Institute

Washington University

Transcript

lnc-PPCS-1:1

Chromosome

chr1

Gene Name

lnc-PPCS-1

Start

42455539

CPC Label

noncoding

End

42455819

Cancer

EOGC

Strand

+

Peptide

AAPVTLAPK

Modified Peptide

n[145]AAPVTLAPK

Peptide Length

9

ORF Length

40

Open Reading Frame (ORF)

LICLPHWNVRSLKELIYRAAPVTLAPKIVHNTEYAFRKHE

Conservation Score

0.482

PhyloCSF Frame 1

-4.518

No. of Spectra

41

CPC Coding Probability

0.0077829

PhyloCSF Frame 2 

-2.425

CNTI Index

noncoding

Max Probability

1

PhyloCSF Frame 3

-3.098

CNTI Score

-0.427173922