McDonnell Genome Institute

Washington University

Transcript

lnc-PPAT-3:1

Chromosome

chr4

Gene Name

lnc-PPAT-3

Start

56522024

CPC Label

noncoding

End

56530481

Cancer

OV

Strand

-

Peptide

LPGSSDSPASASQVAGITGVR

Modified Peptide

n[145]LPGSSDSPASASQVAGITGVR

Peptide Length

21

ORF Length

132

Open Reading Frame (ORF)

LRRNLTLSPRLECSGAISAHCNLRLPGSSDSPASASQVAGITGVRHHTQLIFLFLVETGFHHVGQAGLELLTSGVPPALAFQSAGIIGMGHCACPEPIKFYHLEPVGLFLMCLSLGGGACSEPRSHHCTPAW

Conservation Score

0.946

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.453456

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9827

PhyloCSF Frame 3

0

CNTI Score

-0.365922842