McDonnell Genome Institute

Washington University

Transcript

lnc-PPARA-11:2

Chromosome

chr22

Gene Name

lnc-PPARA-11

Start

46010235

CPC Label

noncoding

End

46234116

Cancer

OV

Strand

+

Peptide

AVMHNLSFSMVRM

Modified Peptide

n[145]AVMHNLSFSMVRM

Peptide Length

13

ORF Length

53

Open Reading Frame (ORF)

LTHCQHGADSALPAVPVTVWLGTSQMKEVLALWHKVYKDKAVMHNLSFSMVRM

Conservation Score

0.054

PhyloCSF Frame 1

-2.668

No. of Spectra

16

CPC Coding Probability

0.0168627

PhyloCSF Frame 2 

-3.587

CNTI Index

noncoding

Max Probability

0.9341

PhyloCSF Frame 3

-3.226

CNTI Score

-0.35516331