McDonnell Genome Institute

Washington University

Transcript

lnc-POU6F2-1:1

Chromosome

chr7

Gene Name

lnc-POU6F2-1

Start

39465091

CPC Label

noncoding

End

39493095

Cancer

BRCA-Luminal A

Strand

+

Peptide

GQVAAGQK

Modified Peptide

n[145]GQVAAGQK

Peptide Length

8

ORF Length

48

Open Reading Frame (ORF)

LSGLWTWLTAHQGLGNTALDHANTETQRGQVAAGQKEQWEGLWPRGAE

Conservation Score

0.166

PhyloCSF Frame 1

-5.029

No. of Spectra

11

CPC Coding Probability

0.0584769

PhyloCSF Frame 2 

-6.005

CNTI Index

noncoding

Max Probability

0.9984

PhyloCSF Frame 3

-5.703

CNTI Score

-0.353508774