McDonnell Genome Institute

Washington University

Transcript

lnc-POU4F3-5:2

Chromosome

chr5

Gene Name

lnc-POU4F3-5

Start

146461840

CPC Label

noncoding

End

146462212

Cancer

OV

Strand

+

Peptide

LQMLNGICMGLGK

Modified Peptide

n[145]LQMLNGICM[147]GLGK

Peptide Length

13

ORF Length

48

Open Reading Frame (ORF)

MMKKSYFSGKLGTMTRYIFSQYSRLQMLNGICMGLGKCCMYFVFFTLL

Conservation Score

1

PhyloCSF Frame 1

-2.678

No. of Spectra

2

CPC Coding Probability

0.0689756

PhyloCSF Frame 2 

-2.329

CNTI Index

noncoding

Max Probability

0.9168

PhyloCSF Frame 3

-2.397

CNTI Score

-0.495835502