McDonnell Genome Institute

Washington University

Transcript

lnc-POU4F2-1:1

Chromosome

chr4

Gene Name

lnc-POU4F2-1

Start

146634626

CPC Label

noncoding

End

146638763

Cancer

OV

Strand

+

Peptide

KGAPPEVTELIHFPSCCLKNK

Modified Peptide

n[145]KGAPPEVTELIHFPSCCLKNK

Peptide Length

21

ORF Length

55

Open Reading Frame (ORF)

LSASARGLDRSYCQTKRLGEKKGAPPEVTELIHFPSCCLKNKMFIFFLLGRSVGV

Conservation Score

1

PhyloCSF Frame 1

-3.83

No. of Spectra

2

CPC Coding Probability

0.0403175

PhyloCSF Frame 2 

-3.278

CNTI Index

noncoding

Max Probability

0.607

PhyloCSF Frame 3

-1.647

CNTI Score

-0.304693762