McDonnell Genome Institute

Washington University

Transcript

lnc-POU3F4-2:1

Chromosome

chrX

Gene Name

lnc-POU3F4-2

Start

82998698

CPC Label

noncoding

End

82999236

Cancer

LUAD

Strand

+

Peptide

LCCGQMMLAQALICR

Modified Peptide

n[43]LCCGQM[147]MLAQALICR

Peptide Length

15

ORF Length

89

Open Reading Frame (ORF)

MLCCGQMMLAQALICRHLGKDCYWEITKRTTTTTIKYQWILQCFLERKNCCYTIHQMAQMHQMAQTSIALASPCTSSQARSDNHWGIIH

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.11117

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7111

PhyloCSF Frame 3

0

CNTI Score

-0.408448421