McDonnell Genome Institute

Washington University

Transcript

lnc-POU3F3-5:4

Chromosome

chr2

Gene Name

lnc-POU3F3-5

Start

104406503

CPC Label

noncoding

End

104419240

Cancer

BRCA-Luminal A

Strand

+

Peptide

LYEIVFR

Modified Peptide

n[145]LYEIVFR

Peptide Length

7

ORF Length

36

Open Reading Frame (ORF)

LRSWQDIIWKTFLKLYEIVFRWIEIQFCFRIVEGFF

Conservation Score

0.516

PhyloCSF Frame 1

-3.307

No. of Spectra

7

CPC Coding Probability

0.0807349

PhyloCSF Frame 2 

-4.862

CNTI Index

noncoding

Max Probability

0.9997

PhyloCSF Frame 3

-5.703

CNTI Score

-0.311193315